PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009592281.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 508aa    MW: 56330 Da    PI: 5.3665
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009592281.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.21.4e-162774148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed +l ++vk++G g+W+++ r  g+ R++k+c++rw ++l
   XP_009592281.1 27 KGPWTATEDAILMEYVKKHGEGNWNAVQRNSGLMRCGKSCRLRWANHL 74
                     79******************************************9986 PP

2Myb_DNA-binding50.74.2e-1680123146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE+ ++++++++lG++ W++ a+ ++ gRt++++k++w++
   XP_009592281.1  80 KGAFSPEEERIIIELHAKLGNK-WARMAAQLP-GRTDNEIKNYWNT 123
                      799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.3142274IPR017930Myb domain
SuperFamilySSF466895.24E-3025121IPR009057Homeodomain-like
SMARTSM007175.3E-132676IPR001005SANT/Myb domain
PfamPF002491.4E-142774IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-232881IPR009057Homeodomain-like
CDDcd001678.97E-112974No hitNo description
PROSITE profilePS5129426.49175129IPR017930Myb domain
SMARTSM007171.9E-1679127IPR001005SANT/Myb domain
PfamPF002493.3E-1580123IPR001005SANT/Myb domain
CDDcd001677.75E-1282125No hitNo description
Gene3DG3DSA:1.10.10.609.2E-2682128IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009555Biological Processpollen development
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0090406Cellular Componentpollen tube
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 508 aa     Download sequence    Send to blast
MALDDRGMKV SSGGGRNGGT SRQALKKGPW TATEDAILME YVKKHGEGNW NAVQRNSGLM  60
RCGKSCRLRW ANHLRPNLKK GAFSPEEERI IIELHAKLGN KWARMAAQLP GRTDNEIKNY  120
WNTRLKRRQR AGLPIYPQEL QPQNQQENNQ HQNLLSSPYD PKRATYNNNN PPSFSLLDIF  180
NPSTMKPSIT QQFPLNNNNI FRDPPKGISL TLPSSIRNSQ FSSLSKSVPN NNFGHGLSNS  240
MPMPSFQNNY PSFNNFTTRP FAGNIHSNPN ELISGIGGIN NINYPSGQSS IPVTASSSEN  300
TGSDFGSSDA NNYANVAGLS RGNSGLLEDL LEESQTLTTR TVKIEDQNNN LDLKEEEADY  360
KGKSLWEDYG LVEEEGEEAI LTEESVYSFA HGVDVTLNSN SESSSPDPKL SSGILKKEVS  420
LQGINQVDDD IMCLLDNFPL AVPVPDWYDE REDKNNSNGQ LSNVTNGDHK AENQAEDSNK  480
SQVVTNSGPR NHDWELGGCC WNNMPSFC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-30251285107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00287DAPTransfer from AT2G32460Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009592281.10.0PREDICTED: transcription factor RAX3
TrEMBLQ029940.0Q02994_PETHY; Protein 3
STRINGPGSC0003DMT4000744860.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.22e-70myb domain protein 101